Sp p00360.3 g3p1_yeast

Author: zhlh

August undefined, 2024

WebP00360. UniProtKB/Swiss-Prot: P00360; G3P1_YEAST. 2D PAGE maps for identified proteins : How to interpret a protein map; You may obtain an estimated location of the protein on … Webgb AEQ53933.1 14-3-3 protein [Triticum aestivum] gb AFL70188.1 14-3-3 protein [Triticum aestivum] contig15110 gb EMS50339.1 hypothetical protein TRIUR3_18239 [Triticum urartu] contig23666 ref XP_003571990.1 PREDICTED: phospholipase D beta 1-like [Brachypodium distachyon] contig93695 gb ABX76295.1 neutral ceramidase [Triticum aestivum]

Entry: - ExPASy - PROSITE

Web23 Jan 2007 · P00360 · G3P1_YEAST. P00360. · G3P1_YEAST. Protein. Glyceraldehyde-3-phosphate dehydrogenase 1. Gene. TDH1. Status. UniProtKB reviewed (Swiss-Prot) WebG3P1_YEAST: Nice View - a user-friendly view of this entry ID G3P1_YEAST; STANDARD; 2DG. AC P00360; DT 01-AUG-1995, integrated into SWISS-2DPAGE (release 2). DT 01-OCT … gold coast theme park ticket

iPTMnet Report P00360 TDH1 - University of Delaware

Webarx1_yeast p38011 gblp_yeast q08004 bud20_yeast p38779 cic1_yeast p24784 dbp1_yeast p24783 dbp2_yeast p06634 ded1_yeast p32324 ef2_yeast a6zwl1 nacb1_yeas7 a6zt99 naca_yeas7 p07149 fas1_yeast p19097 WebTAP Purifications 225 Sus1 ** * MM (kDa) 150 102 76 52 38 31 24 15 12 Asf1 Sup. Figure 1 ! WebEC 1.2.1.12 - Glyceraldehyde-3-phosphate dehydrogenase (phosphorylating) IntEnz view ENZYME view ENZYME: 1.2.1.12 hch 608 bearing

UniProt

WebGlyceraldehyde-3-phosphate dehydrogenase 1: Synonyms: GAPDH 1; Gene Name: TDH1 : Enzyme Class: 1.2.1.12 ; Biological Properties; General Function: Involved in oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor: Specific Function: D-glyceraldehyde 3-phosphate + phosphate + NAD(+) = 3-phospho-D ... hch600space heaterWebLane 1: Yeast lysates probed with GAPDH (Yeast) Polyclonal Antibody, Unconjugated (bs-8789R) at 1:1000 dilution and 4\u00b0C overnight incubation. ... P00360: Synonyms: Y-GAPDH; Yeast GAPDH; G3P1_YEAST; Glyceraldehyde-3-phosphate dehydrogenase 1; Glyceraldehyde-3-phosphate dehydrogenase I; GAPDH I. Application Dilution: WB: 1:300 … gold coast theme park tickets

"http://www.ymdb.ca/proteins/P00360 " - Sp p00360.3 g3p1_yeast

Sp p00360.3 g3p1_yeast

http://www.ymdb.ca/proteins/P00360 Webref NP_012483.3 glyceraldehyde-3-phosphate dehydrogenase (phosphorylating) TDH1 [Saccharomyces cerevisiae S288c] sp P00360.3 G3P1_YEAST RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase 1 ...

Did you know?

http://www.wodaklab.org/iRefWeb/interactor/show/16830189 WebHandle yeast in a suspension form; use non-latex disposable gloves Seek medical assistance Method 1. Set up five water baths of varying temperatures: 20, 30, 40, 50 and …

WebRecombinant Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) TDH1 protein. Validations. None available. Applications. Enzyme-linked immunosorbent assay … WebP00360 (Uniprot) G3P1_YEAST: TDH1: Glyceraldehyde-3-phosphate dehydrogenase 1: yeast: Yes: Protein Function . No associated function. Dissimilar Functions Manual Curation . Function 1: Glycolisis. Glyceraldehyde-3-phosphate dehydrogenase (GAPDH). ... The primary structure of a third yeast glyceraldehyde-3-phosphate dehydrogenase gene.

Web>P22512+3=G3PG_TRYBB/171-333 LAPLVHVLVKEGFGISTGLMTTVHSYTATQKTVDGVSV-KDWRGGRAAALNIIPSTTGAAKAVGMVIPSTQGKLTGMAFR VPTADVSVVDLTFIATRD-TSIKEIDAALKRASK ... Web2 Jan 2012 · glyceraldehyde-3-phosphate dehydrogenase (phosphorylating) Other names: 3-phosphoglyceraldehyde dehydrogenase. NAD-dependent glyceraldehyde phosphate …

Web* G3P1_YEAST * accession n°: P00360 Identification Methods: * MAPPING: {Mi} SWISS-2DPAGE Viewer YEAST { Saccharomyces cerevisiae } (AC: P00360) Back to the search engine: Switch to Gel: Re-scale Gel from 100% to: View: Display: Identified spots Identification details: show hide details: PMF Tandem ...

WebNumerical results for UniProtKB/Swiss-Prot release 2024_05 which contains 568'744 sequence entries. gold coast theme songWebP00360 - G3P1_YEAST. Gene TDH1 Modification Unmodified Mutation Wild type View Product On Supplier's Website Request a Quote from Cusabio. Add to Procurement List Product is on your procurement list. ... Glyceraldehyde-3-phosphate dehydrogenase 1, G3P1_YEAST. UniProt Code History D6VWD1, P00360. hcha afl prior authorization formWeb{"ymdb_id":"YMDB00672","created_at":"2011-05-29T18:42:16.000Z","updated_at":"2016-09-08T18:35:45.000Z","name":"3-phospho-D-glyceroyl dihydrogen phosphate","cas ... gold coast theme park transfersWebP00360 (G3P1_YEAST) Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) Glyceraldehyde-3-phosphate dehydrogenase 1 UniProtKB InterPro STRING … hch alameda countyWeb23 Jan 2007 · Catalyzes the oxidative phosphorylation of glyceraldehyde 3-phosphate (G3P) to 1,3-bisphosphoglycerate (BPG) using the cofactor NAD. The first reaction step involves … hcha formWebP00360 / G3P1_YEAST: Protein Name : Glyceraldehyde-3-phosphate dehydrogenase 1: Gene Name : Name: TDH1 … gold coast theme park tickets dreamworldhttp://www.ymdb.ca/compounds/YMDB00672 hcha insurance